General Information

  • ID:  hor004147
  • Uniprot ID:  P01145
  • Protein name:  Urotensin I
  • Gene name:  NA
  • Organism:  Catostomus commersonii (White sucker) (Cyprinus commersonnii)
  • Family:  Sauvagine/corticotropin-releasing factor/urotensin I family
  • Source:  Animal
  • Expression:  teleost caudal neurosecretory system
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Catostomus (genus), Catostomidae (family), Catostomoidei (suborder), Cypriniformes (order), Cypriniphysae (superorder), Otophysi, Ostariophysi (subcohort), Otomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV
  • Length:  41(1-41)
  • Propeptide:  NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV
  • Signal peptide:  NA
  • Modification:  T41 Valine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  It has a suggested role in osmoregulation and as a corticotropin-releasing factor.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01145-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P01145-F1.pdbhor004147_AF2.pdbhor004147_ESM.pdb

Physical Information

Mass: 558416 Formula: C210H339N61O68S2
Absent amino acids: CW Common amino acids: EL
pI: 4.35 Basic residues: 6
Polar residues: 8 Hydrophobic residues: 13
Hydrophobicity: -70.98 Boman Index: -11647
Half-Life: 1.4 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 97.56
Instability Index: 5431.22 Extinction Coefficient cystines: 1490
Absorbance 280nm: 37.25

Literature

  • PubMed ID:  6981844
  • Title:  Complete amino acid sequence of urotensin I, a hypotensive and corticotropin-releasing neuropeptide from Catostomus.
  • PubMed ID:  6313156
  • Title:  Isolation, analysis of structure, synthesis, and biological actions of urotensin I neuropeptides.